Protein Info for BBR_RS17290 in Bifidobacterium breve UCC2003

Annotation: Fused ATP-binding protein and permease of ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 783 transmembrane" amino acids 548 to 578 (31 residues), see Phobius details amino acids 590 to 609 (20 residues), see Phobius details amino acids 627 to 649 (23 residues), see Phobius details amino acids 762 to 782 (21 residues), see Phobius details PF00005: ABC_tran" amino acids 31 to 183 (153 residues), 109.8 bits, see alignment E=9.9e-35 amino acids 296 to 454 (159 residues), 115.1 bits, see alignment E=2.2e-36 PF13304: AAA_21" amino acids 409 to 484 (76 residues), 39 bits, see alignment E=5.2e-13 PF02361: CbiQ" amino acids 535 to 756 (222 residues), 122.1 bits, see alignment E=1.5e-38

Best Hits

Predicted SEED Role

"FIG01281365: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (783 amino acids)

>BBR_RS17290 Fused ATP-binding protein and permease of ABC transporter (Bifidobacterium breve UCC2003)
MTESAHNPAYAHAAELKNIRFSYDRGNSWALDGVSLTVRAGERICLVGPNGSGKSTFARL
IAGLAAPDGGDITLLGHRAYADALPNADEYRAARRGIGVVFQNPEDQLVTTVLEDDVAFG
PENLGIERSRIGERIDDSLKSVGLVSFRQSDPTRMSGGQQQRAAIAGMLAMSPAMLVLDE
PTAMLDESARAEVMRILDDLQAQGTTIVHVTHHQDETVHADRIVHMESGQIVGIEAVSAR
PQTIANHPSPDEPHQPGRDVAFPLLSDASNDDATDPIIRVSHVTYRYSSAKHATINDLSF
TIARGQTVALMGANGSGKSTLIRLLCALATPRSGSIDIANVPVATSTGTGTRSKSATRQQ
LVQLRRHVGYVMQHPEHQLFADTVAEDVAYGPRNQGLAETEVADRVHEALELLHIGHLAD
RSPFDLSGGQQRLAAIAGVIACNPDVLIMDEPTASLDTQAKVRIHELLRTLKQQGVTVLL
ITHDRAEAEALADRVVRMPNAAEQPDSPASDALNNSNTEASASNTTSASADAAFSVIHRL
DPRVKMVGFLAAMFTMFAVNTPVQLVLGLMVTLAVIAAARLNPLWVLKSIHPLLMLMLLM
GIVNLFVVRTGTPVVALGPLSITDQGVTIAVLYTCRFMLVIILGTVFLTTTTPTAMTDAF
AALIKPLNRLGVHAQEIALVMSLALRFIPTLTDETRAIIDAQSARGGSIETGSLGQRIKA
MSAIIVPTFAGTLRHADNLSLALDARCYEEGIHRTHWRALSIAGRDIVFAALVIAYIASI
ILL