Protein Info for BBR_RS17285 in Bifidobacterium breve UCC2003

Annotation: ECF transporter S component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 53 to 74 (22 residues), see Phobius details amino acids 85 to 109 (25 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 147 to 172 (26 residues), see Phobius details amino acids 180 to 207 (28 residues), see Phobius details PF07155: ECF-ribofla_trS" amino acids 48 to 210 (163 residues), 43.7 bits, see alignment E=3.2e-15 PF12822: ECF_trnsprt" amino acids 51 to 207 (157 residues), 68.2 bits, see alignment E=9.1e-23

Best Hits

KEGG orthology group: None (inferred from 93% identity to blf:BLIF_1450)

Predicted SEED Role

"Substrate-specific component RibU of riboflavin ECF transporter" in subsystem ECF class transporters or Riboflavin, FMN and FAD metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>BBR_RS17285 ECF transporter S component (Bifidobacterium breve UCC2003)
MSISSRIRMQAIRSVAPQAEGAGSGSTSTSSSTKLGSHATGVADSGRWSTRRIAMYALFV
ALAMVTSFIEFPITPVTWLKYDPSGIVCLIAGFAYGPAAAAIVSVLGFVPHMFANPWGSL
MAVLVALFLSVPAAFIYRKIRTRKGAAIGILVGAVLAIVVALVGNLIVTPIYAHMTYQAV
AAMILPILLPFNLAKMAIHAVITFLIYKPVSNLLSKQQ