Protein Info for BBR_RS17260 in Bifidobacterium breve UCC2003

Annotation: Sucrose permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details PF01306: LacY_symp" amino acids 10 to 144 (135 residues), 105.3 bits, see alignment E=3.4e-34 PF12832: MFS_1_like" amino acids 19 to 143 (125 residues), 47.7 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: K02532, MFS transporter, OHS family, lactose permease (inferred from 99% identity to bll:BLJ_1362)

Predicted SEED Role

"Sucrose permease, major facilitator superfamily" in subsystem Sucrose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>BBR_RS17260 Sucrose permease (Bifidobacterium breve UCC2003)
MINAGGVTRWAGALIGSIVLSAGFMAACSLSEAVTERYSRKFNFEYGQSRAWGSFSYAIV
ALCAGFLFNISPMINFWIGTACGVGMLLTYLFWVPAEQKEELKKEADPNAEKTNPSFKEM
VGVLKMPTLWVLIVFMLLTNTFYTDKQLRQMEAAKA