Protein Info for BBR_RS17255 in Bifidobacterium breve UCC2003

Annotation: ClbS/DfsB family four-helix bundle protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF08020: DUF1706" amino acids 1 to 169 (169 residues), 182.4 bits, see alignment E=3.4e-58

Best Hits

Swiss-Prot: 49% identical to IRC4_YEAST: Uncharacterized protein IRC4 (IRC4) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 99% identity to bll:BLJ_1361)

Predicted SEED Role

"DUF1706 domain-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>BBR_RS17255 ClbS/DfsB family four-helix bundle protein (Bifidobacterium breve UCC2003)
MRTYENAQELKEEISAAFRKYIAEFDDIPEALKDKRIDEVERTPAENLAYQVGWTTLLLQ
WEDRERRGLPVRTPSDEFKWNQLGKLYRWFNDTYAHLSLRELEGMLTDNVDAIYMMIDAM
SEDELFKPHMRQWADDATKTAVWEVYRFIHVNTVAPFGSFRTKIRKWKRMAL