Protein Info for BBR_RS17250 in Bifidobacterium breve UCC2003

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF00356: LacI" amino acids 3 to 50 (48 residues), 52.6 bits, see alignment 4.8e-18 PF00532: Peripla_BP_1" amino acids 62 to 314 (253 residues), 84.2 bits, see alignment E=1.7e-27 PF13377: Peripla_BP_3" amino acids 171 to 313 (143 residues), 82.2 bits, see alignment E=7.3e-27

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 100% identity to bll:BLJ_1360)

Predicted SEED Role

"probable LacI-type transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>BBR_RS17250 LacI family DNA-binding transcriptional regulator (Bifidobacterium breve UCC2003)
MATMKEIANKAGVSVSTVSLVLNGRDEGRVKSEIADNVRAIATKLGYRSNPLASSLRTGK
THILGFISEEVATTPYAGGMILGAQTAASQFGYMLITVSTDGENSESEEIAALKRYGTDG
FLYAKMSNRITHAPSSLAKTPLVLVDATDSLGKIPSVEPDEFQIGYDATTRLVKAGCARI
AYVGCSEPMIAQDGRLEGYQAALRDACLDYDDRLVVNVLNNGPALTAVSDLFDAEHPDGF
FCFNDARAWYVYECAARRGLTVGKDISVIGVDNHRVFAETLEPMLTTVELPHFEMGYWAV
AKLVSIIEGRSMDDVSRPATTAPLPPIDAPIPAKIHCTLIEKASVK