Protein Info for BBR_RS17225 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 49 to 70 (22 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 144 to 161 (18 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 202 to 218 (17 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details amino acids 365 to 388 (24 residues), see Phobius details amino acids 400 to 423 (24 residues), see Phobius details amino acids 429 to 451 (23 residues), see Phobius details PF07690: MFS_1" amino acids 56 to 390 (335 residues), 113 bits, see alignment E=1.5e-36 amino acids 314 to 449 (136 residues), 37.4 bits, see alignment E=1.5e-13 PF00083: Sugar_tr" amino acids 77 to 457 (381 residues), 127.2 bits, see alignment E=8.7e-41

Best Hits

KEGG orthology group: K08369, MFS transporter, putative metabolite:H+ symporter (inferred from 100% identity to bll:BLJ_1355)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>BBR_RS17225 MFS transporter (Bifidobacterium breve UCC2003)
MTAAEQQISGNPAAMESAQARTTVTDQAKVQDIISRVDRAHETPMFHRIVALVAAGMLMD
SIDVYIGSAVASSALATHWSTVAQNSTFMSAGFLGLLVGSLLAGFVGDLKGRRVAYQINL
LLFGGFTFLGAFAPNMAVLSLCRLGAGLGLGAEIVTGFAMVNEFAPMNRRGHWCAIVSLV
ANCGVPIAMLLCAWIIPRWSWRPLFVAIGLGAAIIWWLRRDIPESPRWLAVHGRYDEADA
IVKQLEANGSELIDAAAKADTSDTRNAGGRSLGICLLVAVVAVAATNVCSYAFTSWVPTI
LVKRGINLSSSLLTSTAMMLGAPVGCLIGSLLIDRIGRKRTIVPAFLFTGVFGLMYAFQT
STVSAIIVGFLLMMCLYVLMASVVAVYAPELFATKVRFRCVGFANAVAKLLNVLMPMVVG
WMLTSLGATSIFVAISAIAIASMLIVGFFGAETAQKSVG