Protein Info for BBR_RS17210 in Bifidobacterium breve UCC2003

Annotation: 26S protease regulatory subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF05496: RuvB_N" amino acids 184 to 262 (79 residues), 31 bits, see alignment E=3e-11 PF00004: AAA" amino acids 190 to 319 (130 residues), 139.3 bits, see alignment E=1.6e-44 PF17862: AAA_lid_3" amino acids 345 to 384 (40 residues), 39.4 bits, see alignment 5.1e-14

Best Hits

KEGG orthology group: K13525, transitional endoplasmic reticulum ATPase (inferred from 98% identity to bll:BLJ_1352)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>BBR_RS17210 26S protease regulatory subunit (Bifidobacterium breve UCC2003)
MADNDVLRRDGVLVRITGFDDERTAYFGVMPNGHTTQLTFPRQEVFDVGDVLLVGTDFYR
KVPHDVWPLKPRVGIVRRALNEGVVLETSDGLELLEGDYPNSIMPGNTVQFTDLFGIERV
LWPTAIRPGESDHDDDIKQYRITPGSDPSLTFDSFGGYEQVITRAKELIETQLGNSAQMR
AIGAKPIKGVIFTGAPGTGKTHLARIIANVADAQFYLVSGPTIVSKYVGDSEETLRMIFA
AAQADKRAIIFFDEIDSIASSRENDTNGVGKRLVAQLLTLMDGFESKGNVVVVAATNRIE
DVDPALLRPGRFDWQIPFPMPSERDRLGILQVQAHSLSIEGELPLEDIARRTEGWSGAEV
CAIWTEAALVAAKDRRGAIRAADLVTAFERVERRPELRHHK