Protein Info for BBR_RS17155 in Bifidobacterium breve UCC2003

Annotation: cell division protein SepF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF04472: SepF" amino acids 70 to 141 (72 residues), 79.2 bits, see alignment E=1.1e-26

Best Hits

Swiss-Prot: 84% identical to SEPF_BIFLO: Cell division protein SepF (sepF) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K09772, cell division inhibitor SepF (inferred from 84% identity to blb:BBMN68_166)

Predicted SEED Role

"FIG021292: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>BBR_RS17155 cell division protein SepF (Bifidobacterium breve UCC2003)
MAGFMKNAMSYLGMSDVVDDDDEYFDEEDEQQPEAKPSFDSDRTVTPIAQSTASPSAKTS
PFQGGRVNRITTIHPKSYEDAQLVGRALRDGVPVVLNLTGVPEAVAYRIVDFSAGVVFGV
RGSLERVTPRVFLLSPAQVNIKVEEPTTTASAHDLFAN