Protein Info for BBR_RS17135 in Bifidobacterium breve UCC2003

Annotation: RluA family pseudouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 TIGR00005: pseudouridine synthase, RluA family" amino acids 12 to 301 (290 residues), 261.4 bits, see alignment E=5.4e-82 PF00849: PseudoU_synth_2" amino acids 85 to 240 (156 residues), 98.6 bits, see alignment E=2.1e-32

Best Hits

Swiss-Prot: 50% identical to Y1540_MYCTO: Uncharacterized RNA pseudouridine synthase MT1592 (MT1592) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K06180, ribosomal large subunit pseudouridine synthase D [EC: 5.4.99.12] (inferred from 92% identity to bln:Blon_0805)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase D (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>BBR_RS17135 RluA family pseudouridine synthase (Bifidobacterium breve UCC2003)
MSRMVPAPDALIGKRFDVAVAKMLGISRSKAADLIDSGQARVLGREVARSSSLMAGETVE
FDLVENHVEPEPIANDMAVVYEDDDVVVVDKPVGVAAHASVGWSGPTVLGSLRDRGVRIT
SYGAAGREGIVSRLDVGTSGLMLVCKSELAYTEMRRQFAEHEVKKTYHALVQGGLKEDKA
TIEAPIGRAKVSDFRFCITPAGKPAITHWDVLERFDHEATLVSVNLETGRTHQIRVHFSS
IGHPLCGDPMYGANPVLSEALGLDRQWLHAMKLEFRHPRTRVWTTVESHYPADLAAALDV
MRARHTEPVESLVD