Protein Info for BBR_RS17115 in Bifidobacterium breve UCC2003

Annotation: aldo/keto reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00248: Aldo_ket_red
  • amino acids 23 to 198 (176 residues), 142.8 bits, E=6.4e-46
  • amino acids 206 to 264 (59 residues), 35.3 bits, E=3.5e-13

Best Hits

Swiss-Prot: 51% identical to DKGA_CORSC: 2,5-diketo-D-gluconic acid reductase A (dkgA) from Corynebacterium sp. (strain ATCC 31090)

KEGG orthology group: None (inferred from 80% identity to bbp:BBPR_0520)

MetaCyc: 51% identical to 2,5-diketo-D-gluconate reductase A monomer (Corynebacterium sp. SHS 0007)
RXN0-7020 [EC: 1.1.1.346]

Predicted SEED Role

"oxidoreductase of aldo/keto reductase family, subgroup 1"

MetaCyc Pathways

• L-ascorbate biosynthesis VIII (engineered pathway) (2/7 steps found)
• ketogluconate metabolism (1/8 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.346

Protein Sequence (293 amino acids)

>BBR_RS17115 aldo/keto reductase (Bifidobacterium breve UCC2003)
MTQVLQSPGITLQNKAHTVIPQIGFGTFQIPPEDTQRAVEEALEIGYRHIDTAAAYYNEE
QVGDALRATGMANKVWVTTKLRNCDQGYDPARIAFEESRRKLGVDVVDMYLIHWPFPAVD
LYKETWKALLKLQEEGAIRVAGVSNFLPEHLQAVSDDSGETPTVNQIEVHPRFSQPDNLA
FCKAHGITVEAYSPLGHGKDIESEPVVSAAEAHNVTPAQVVLRWHTQEGRIIIPKSKHVE
RMKSNLASASFDLTATELAAIDALHDPKGNVSADPATFVQSQSWANQHSRGNI