Protein Info for BBR_RS17060 in Bifidobacterium breve UCC2003

Annotation: acylphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00708: Acylphosphatase
  • amino acids 21 to 103 (83 residues), 85.4 bits, E=1.3e-28

Best Hits

Swiss-Prot: 64% identical to ACYP_BIFLO: Acylphosphatase (acyP) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K01512, acylphosphatase [EC: 3.6.1.7] (inferred from 64% identity to blo:BL1294)

Predicted SEED Role

"Acylphosphate phosphohydrolase (EC 3.6.1.7), putative" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 3.6.1.7)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.7

Protein Sequence (107 amino acids)

>BBR_RS17060 acylphosphatase (Bifidobacterium breve UCC2003)
MNHWSKNHSLQEQASDVVRKHMVITGLVQGVGFRYFTVMQARQLGVSGWVRNRYDGLVEV
EAQGSQESVQALVKQLKLGPRWSDVRHIDIQDVPVKDDAPSAFRVLE