Protein Info for BBR_RS17050 in Bifidobacterium breve UCC2003
Annotation: histidinol-phosphate transaminase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 97% identical to HIS8_BIFLO: Histidinol-phosphate aminotransferase (hisC) from Bifidobacterium longum (strain NCC 2705)
KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 97% identity to bln:Blon_0824)Predicted SEED Role
"Histidinol-phosphate aminotransferase (EC 2.6.1.9)" in subsystem Histidine Biosynthesis (EC 2.6.1.9)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (39/46 steps found)
- superpathway of aromatic amino acid biosynthesis (18/18 steps found)
- L-histidine biosynthesis (10/10 steps found)
- superpathway of L-phenylalanine biosynthesis (10/10 steps found)
- superpathway of L-tyrosine biosynthesis (10/10 steps found)
- L-phenylalanine biosynthesis I (3/3 steps found)
- L-tyrosine biosynthesis I (3/3 steps found)
- 3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
- L-tyrosine degradation II (1/2 steps found)
- atromentin biosynthesis (1/2 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- L-phenylalanine degradation II (anaerobic) (1/3 steps found)
- L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
- 4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
- L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
- L-tyrosine degradation I (1/5 steps found)
- L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
- superpathway of plastoquinol biosynthesis (1/5 steps found)
- L-phenylalanine degradation IV (mammalian, via side chain) (1/9 steps found)
- rosmarinic acid biosynthesis I (1/10 steps found)
- (S)-reticuline biosynthesis I (1/11 steps found)
- superpathway of rosmarinic acid biosynthesis (1/14 steps found)
- superpathway of chorismate metabolism (32/59 steps found)
- anaerobic aromatic compound degradation (Thauera aromatica) (1/27 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis II
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of phenylpropanoids
- Histidine metabolism
- Novobiocin biosynthesis
- Phenylalanine metabolism
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Tyrosine metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.6.1.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-positive bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (386 amino acids)
>BBR_RS17050 histidinol-phosphate transaminase (Bifidobacterium breve UCC2003) MSSIPANLPLRNDLIGEEPYGAPQLDVPVCLNVNENPYAPDPAVCDTIAKRVREIAPTLN RYPDREHIELRQAFSDYLARESGARLDVDELWGANGSNEIMLQLFQAFGGPGRTALGADP TYSMYPEYARDTFTGWKLAHRNADFTLNVDKVLEAVNEVKPSMVLLTSPNNPTGTPLPME DIERILAACETAEVAGAGEGIHPILVIDEAYVEFRKPGTPSAVSLIKNHPNLAVSRTMSK AFAFAGARVGYLAASKGIIDCVRIVRMPYHLSAVTQAAALAAFEHTDEQLSRVEHLREIR EATASWLKEQTYKGQPLEVAESGSNFLLFGGHFDNREAIFDELLKRGVLIRVVGPDGWLR VCMGTDEEMETFRNALAEVLRIVEAA