Protein Info for BBR_RS17030 in Bifidobacterium breve UCC2003

Annotation: bifunctional 1-(5-phosphoribosyl)-5-((5- phosphoribosylamino)methylideneamino)imidazole-4- carboxamide isomerase/phosphoribosylanthranilate isomerase PriA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR01919: bifunctional HisA/TrpF protein" amino acids 1 to 241 (241 residues), 442.5 bits, see alignment E=1.9e-137 PF00977: His_biosynth" amino acids 5 to 231 (227 residues), 221.9 bits, see alignment E=4e-70

Best Hits

Swiss-Prot: 98% identical to HIS4_BIFLS: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisA) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] (inferred from 97% identity to blj:BLD_0157)

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16) / Acting phosphoribosylanthranilate isomerase (EC 5.3.1.24)" in subsystem Tryptophan synthesis or Histidine Biosynthesis (EC 5.3.1.16, EC 5.3.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.24

Use Curated BLAST to search for 5.3.1.16 or 5.3.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>BBR_RS17030 bifunctional 1-(5-phosphoribosyl)-5-((5- phosphoribosylamino)methylideneamino)imidazole-4- carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (Bifidobacterium breve UCC2003)
MSLTLLPAVDVRDGKAVRLRQGESGSETDYGSPFEAARTWVEAGAEWIHLVDLDAAFGTG
NNRDQLREIVHELGDRVNIELSGGVRDDDSLDAALEAGAARVNIGTAALENPDWTASVIK
KYGDRVAVGLDVRGHTLAARGWTKEGGDLFETMKFLDSVGCSRYVVTDVAKDGMMSGPNI
GLLREVAERTDAKVTASGGISKLDDLRAIKTLAEIGVDSAILGKSLYARAFTLQEALEVA
R