Protein Info for BBR_RS17020 in Bifidobacterium breve UCC2003

Annotation: type I glutamate--ammonia ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR00653: glutamine synthetase, type I" amino acids 9 to 442 (434 residues), 452.7 bits, see alignment E=6.8e-140 PF03951: Gln-synt_N" amino acids 16 to 98 (83 residues), 97.8 bits, see alignment E=2.3e-32 PF00120: Gln-synt_C" amino acids 105 to 441 (337 residues), 416.5 bits, see alignment E=8.5e-129

Best Hits

Swiss-Prot: 61% identical to GLN1A_MYCTU: Glutamine synthetase (glnA2) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01915, glutamine synthetase [EC: 6.3.1.2] (inferred from 98% identity to bll:BLJ_1324)

MetaCyc: 45% identical to GlnA (Thermotoga maritima)

Predicted SEED Role

"Glutamine synthetase type I (EC 6.3.1.2)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Glutamine synthetases or Peptidoglycan Biosynthesis (EC 6.3.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.2

Use Curated BLAST to search for 6.3.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>BBR_RS17020 type I glutamate--ammonia ligase (Bifidobacterium breve UCC2003)
MDRQQEFALRTVEERDVRFIRLWFTDVLGTLKSVAIAPAELEAAFEEGLGFDGSAIEGMT
RVSEDDMIVQPDPSTFQILPWRGGPQGTARMFCDILTPDGEPSLGDPRHVLKRALAKAKD
KGFTFYVHPEIEFYLFESQDDWSKAPTPIDEGGYFDHVPRSPGMDFRRATVNMLEQMGIS
VEYSHHEAGPGQNEIDLRYADALTTADNIMTFRTVVKEISLERGIHASFMPKPLADAPGS
GMHTHLSLFEGDSNAFYEAGQEFNMSLTARQFAAGILYHAAEICAVTDQYVNSYKRLWGG
NEAPSYICWGHNNRSALLRIPQYKPGKGNSARMEFRALDPVANPYLAYSVLLAAGLDGID
KQMQLGEPTSDDVWELTDGERQAMGIQPLPSSLDEALKIMERSDFVADVLGEHAFGYFLD
NKRQEWAEYNQQVTPYELKKYLPKL