Protein Info for BBR_RS17005 in Bifidobacterium breve UCC2003

Annotation: methyltransferase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF05175: MTS" amino acids 29 to 212 (184 residues), 99.3 bits, see alignment E=5.9e-32 PF06325: PrmA" amino acids 61 to 113 (53 residues), 24.7 bits, see alignment E=4.8e-09 PF13847: Methyltransf_31" amino acids 61 to 120 (60 residues), 29.8 bits, see alignment E=1.4e-10 PF13649: Methyltransf_25" amino acids 62 to 125 (64 residues), 38.3 bits, see alignment E=5.4e-13 PF02390: Methyltransf_4" amino acids 62 to 117 (56 residues), 25.1 bits, see alignment E=3.2e-09 PF08241: Methyltransf_11" amino acids 63 to 124 (62 residues), 21.8 bits, see alignment E=7.1e-08

Best Hits

KEGG orthology group: None (inferred from 87% identity to bll:BLJ_1313)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52)" (EC 2.1.1.52)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>BBR_RS17005 methyltransferase domain-containing protein (Bifidobacterium breve UCC2003)
MAEQYFSAEPSSKDVRRTLNVTLQGHDAQVQVSNGVFSGSRVDLGTSALLKHAPEPPVSG
NVLDLGCGWGPIALALAFASPEANVWAVDVNERALELTHVNAEANGCRNIHTTQVDETST
PLPADRQSAHCEPIPGDLTFDAIWSNPPIRIGKEALHTLLMAWLPKLKVGGAAYLVVQKN
LGSDSLIPWLDESLGEGFTASKYASSKGFRIIEVRHEI