Protein Info for BBR_RS17000 in Bifidobacterium breve UCC2003

Annotation: GTPase HflX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 TIGR03156: GTP-binding protein HflX" amino acids 82 to 442 (361 residues), 423.6 bits, see alignment E=5.5e-131 PF13167: GTP-bdg_N" amino acids 99 to 187 (89 residues), 110.1 bits, see alignment E=1.3e-35 PF16360: GTP-bdg_M" amino acids 189 to 275 (87 residues), 96.2 bits, see alignment E=2.8e-31 TIGR00231: small GTP-binding protein domain" amino acids 282 to 440 (159 residues), 44.5 bits, see alignment E=1.4e-15 PF02421: FeoB_N" amino acids 282 to 373 (92 residues), 30.1 bits, see alignment E=6.7e-11 PF01926: MMR_HSR1" amino acids 282 to 402 (121 residues), 76 bits, see alignment E=5.2e-25

Best Hits

KEGG orthology group: K03665, GTP-binding protein HflX (inferred from 92% identity to blo:BL1307)

Predicted SEED Role

"GTP-binding protein HflX" in subsystem Hfl operon or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>BBR_RS17000 GTPase HflX (Bifidobacterium breve UCC2003)
MTDNTQYTDIDRSDADEAPSGVLSGQSNVLLDDTQRAAGWHEDSNQEWEEREARNELKHV
AGLGELQDVTEVEYRKVRLERVVLVGVWSSAVTTQAKAEESLRELAALAETAGAVVCDGL
LQHRSKPDAATYVGSGKAREIADIVAREEADTIVVDDDLAPSQRRALEDAAKVKVVDRTA
VILDIFAQHATSREGKAQVELAQLEYMLPRLRGWGGSLSRQAGGRAAGADAGIGSRGPGE
TKIEMDRRVIRARIARLRRQIREMAPAREIKRGSRRRFGLPTVAVVGYTNAGKSSLTNRL
TGSAELVENALFATLDTAVRRAKTHDGRAFAYVDTVGFVRRLPTQLVEAFKSTLEEVGEA
DVIVHVVDGSHPDPFSQIDAVNDVLADIEGTASIPRILVFNKADQIDDAKRERLAALQPD
AFIVSAYSGKGLDALRDAVEELLPVPHVHINALLPYTAGSLLSRVREYGKVDSVEYRDSG
VALEADVDSHLAAQIMEQSIA