Protein Info for BBR_RS16995 in Bifidobacterium breve UCC2003

Annotation: L-lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00056: Ldh_1_N
  • amino acids 9 to 148 (140 residues), 158.7 bits, E=1.4e-50
• PF03807: F420_oxidored
  • amino acids 10 to 87 (78 residues), 24 bits, E=7.3e-09
• TIGR01771: L-lactate dehydrogenase
  • amino acids 13 to 313 (301 residues), 396.6 bits, E=3.7e-123
• PF02866: Ldh_1_C
  • amino acids 151 to 314 (164 residues), 131.5 bits, E=5.1e-42

Best Hits

Swiss-Prot: 97% identical to LDH2_BIFLO: L-lactate dehydrogenase 2 (ldh2) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K00016, L-lactate dehydrogenase [EC: 1.1.1.27] (inferred from 97% identity to blm:BLLJ_1290)

MetaCyc: 97% identical to L-lactate dehydrogenase subunit (Bifidobacterium longum)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.1.27)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.27)

MetaCyc Pathways

• Bifidobacterium shunt (15/15 steps found)
• heterolactic fermentation (16/18 steps found)
• homolactic fermentation (11/12 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• methylglyoxal degradation V (2/3 steps found)
• L-histidine degradation V (1/2 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (3/8 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (4/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.27

Use Curated BLAST to search for 1.1.1.27

Protein Sequence (320 amino acids)

>BBR_RS16995 L-lactate dehydrogenase (Bifidobacterium breve UCC2003)
MAETTVKPTKLAVIGAGAVGSTLAFAAAQRGVAREIVLEDIAKERVEAEVLDMQHGSSFY
PTVSIAGSDDPEICRDADMVVITAGPRQKPGQSRLELVGATVNILKAIMPNLVKVAPNAI
YMLITNPVDIATHVAQKITGLPENQVFGSGTNLDSARLRFLIAQQTGVNVKNVHAYIAGE
HGDSEVPLWASATIGGVPMCDWTPLPGHEPLDAAKREEIHQEVKNAAYKIINGKGATNYA
IGMSGVDIIEAVMHDTNRILPVSSMLKDFHGISDICMSVPTLLNRQGVNTAINTPVSDKE
LAALKRSAETLKETAAQFGF