Protein Info for BBR_RS16990 in Bifidobacterium breve UCC2003

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 25 to 50 (26 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 21 to 303 (283 residues), 214.1 bits, see alignment E=1.3e-67 PF01545: Cation_efflux" amino acids 24 to 218 (195 residues), 121.9 bits, see alignment E=3.1e-39

Best Hits

Swiss-Prot: 37% identical to CZCD_CUPMC: Metal cation efflux system protein CzcD (czcD) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 90% identity to bln:Blon_0841)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>BBR_RS16990 cation transporter (Bifidobacterium breve UCC2003)
MAHNHAPTPSPSSGVDAAAHQRRLIATLAVTGSVFLIEVISAVLTGSLALLVDAGHMLTD
MSVLVASTITAALMRRKPSNTRTWGWARLEVITAAAGAVVLLIVGIYALIEAGMRLFGGS
KAEIDDIGLLLFVGILGLAANIISIFILASQRKDNMNMKAAFLEVMNDALGSVAVVASAL
VMISTGWNGFDAVAGAVIALMMIPRAIKLLSNAVKVLLEETPEGLDLDKVREHLENVPHV
VAVHDLHASTVSTGMPILMAHVVVERGLTMEQAAGILTQLQDCLREHFPVSVPHTTFQLE
PEGYSSPSSNELHE