Protein Info for BBR_RS16955 in Bifidobacterium breve UCC2003

Annotation: 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR00006: 16S rRNA (cytosine(1402)-N(4))-methyltransferase" amino acids 6 to 314 (309 residues), 297.8 bits, see alignment E=5.3e-93 PF01795: Methyltransf_5" amino acids 7 to 314 (308 residues), 344.4 bits, see alignment E=3.6e-107

Best Hits

Swiss-Prot: 83% identical to RSMH_BIFLD: Ribosomal RNA small subunit methyltransferase H (rsmH) from Bifidobacterium longum (strain DJO10A)

KEGG orthology group: K03438, S-adenosyl-methyltransferase [EC: 2.1.1.-] (inferred from 83% identity to blo:BL1316)

Predicted SEED Role

"rRNA small subunit methyltransferase H" in subsystem Bacterial Cell Division

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>BBR_RS16955 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH (Bifidobacterium breve UCC2003)
MIDVTNIHQPVLLDDCVNLVAPALQHEGAVAVDCTLGLAGHSTAFLKAAPQARLIGIDRD
SEALALATERMVQEGLSDRFTPVHAAFDQLDQVLADQGVERVDAVFMDLGLSSLQIDETD
RGFSYSHDAPLDMRMDVSQNLTAERILADYDMASLIRVFREYGEERFARQIAREIVLRRT
QTPFTTTGQLNALVEDVVPKAHRPAGNPAKRVFQALRIEVNGELDKLSSTLPQAANRLQV
GGRLVVESYHSLEDKTVKSFMAQGLKIDAPANLPIVPDDAQLFFRELTRGAIKADDEERQ
RNPRSASVRLRAVELSRRIPERWRERFAQTAANPKESNTTRNNGKHGRRG