Protein Info for BBR_RS16895 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 37 to 60 (24 residues), see Phobius details amino acids 67 to 91 (25 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details PF07690: MFS_1" amino acids 4 to 177 (174 residues), 38 bits, see alignment E=4.9e-14

Best Hits

Predicted SEED Role

"Predicted glucose transporter in maltodextrin utilization gene cluster" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (194 amino acids)

>BBR_RS16895 MFS transporter (Bifidobacterium breve UCC2003)
MFLCFLGIVAHVGVDVGINAQAPRILTEHTGDTFTEIAATATMVYFIARMIGCFTGGIVL
SKISNHVGILVCGIIMTASAVCFTIFCSITSNLPAALFWVAVALVGFGNSNAFLLFLSHA
LMYRPERQNEISGLMFMSLIGGAIFPPIMGALADAMNAQLGTIIVMAVGCLYVLVIGVGY
KAIIEGKKAAQVEA