Protein Info for BBR_RS16885 in Bifidobacterium breve UCC2003

Annotation: carbohydrate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00294: PfkB
  • amino acids 21 to 281 (261 residues), 123.7 bits, E=1e-39

Best Hits

KEGG orthology group: K00847, fructokinase [EC: 2.7.1.4] (inferred from 95% identity to blb:BBMN68_230)

Predicted SEED Role

"Sugar kinases, ribokinase family"

MetaCyc Pathways

• heterolactic fermentation (16/18 steps found)
• sucrose degradation III (sucrose invertase) (4/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• D-sorbitol degradation I (2/3 steps found)
• sucrose degradation I (sucrose phosphotransferase) (1/3 steps found)
• mannitol cycle (2/5 steps found)
• sucrose degradation VII (sucrose 3-dehydrogenase) (1/4 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.4

Use Curated BLAST to search for 2.7.1.4

Protein Sequence (298 amino acids)

>BBR_RS16885 carbohydrate kinase (Bifidobacterium breve UCC2003)
MTTPIVLSLGELLWDMLPGGKRAGGAPVNFAYHAMKNGTEGWAISAVGEDELGDELIAKA
DEAGINTVIQRNAWPTSTVEVALKNGIPEYTIVKGVAWDHILYTRQLINVVSKADAVCFG
TLALRSPESHATITELLKHTKPGAMKFFDINLRGDHYSKELIEELLKAATVFKINDEELL
LLRDMFDIRGTSGEDASRWFLDEFDLDYVILTAGSAYSTIMSRKGAVSTLDTPHVEVVDT
VGAGDSFSGTFTARTLLGDSLADAHRKAVNTAAFVCTQAGAWPEYPAEMPDYLVAAGK