Protein Info for BBR_RS16865 in Bifidobacterium breve UCC2003

Annotation: glucosamine-6-phosphate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00502: glucosamine-6-phosphate deaminase
  • amino acids 4 to 255 (252 residues), 243.9 bits, E=9e-77
• PF01182: Glucosamine_iso
  • amino acids 18 to 236 (219 residues), 70 bits, E=1.4e-23

Best Hits

Swiss-Prot: 96% identical to NAGB_BIFLO: Glucosamine-6-phosphate deaminase (nagB) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K02564, glucosamine-6-phosphate deaminase [EC: 3.5.99.6] (inferred from 96% identity to bll:BLJ_1271)

Predicted SEED Role

"Glucosamine-6-phosphate deaminase (EC 3.5.99.6)" in subsystem Chitin and N-acetylglucosamine utilization or Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.99.6)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• N-acetylglucosamine degradation II (3/3 steps found)
• N-acetylglucosamine degradation I (2/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (4/6 steps found)
• chitin derivatives degradation (3/8 steps found)
• chitin degradation I (archaea) (2/7 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.99.6

Use Curated BLAST to search for 3.5.99.6

Protein Sequence (270 amino acids)

>BBR_RS16865 glucosamine-6-phosphate deaminase (Bifidobacterium breve UCC2003)
MPEIIIVKNEAEAGEIYGRCVADLIKAKPNAVLGLATGSSPLAAYQALAKIVHDESIDIS
QVSGYALDEYIGLPLTHPESYHATIHRTVVEPLGLDPSKVHVPGDVLNGAPLEDGDKVAL
AGPAYDRAIEAAGGIDVQILGIGTDGHVGFNEPGSSLASGTRVKTLAEQTRVDNARFFDN
DINQVPTHCITQGIGTIMKARHLVLLAFGAGKAEAIEETVEGGVSAFCPASALQMHPHAT
IIVDEEAASRLRHKDYYRYAYTHKPAWQGI