Protein Info for BBR_RS16820 in Bifidobacterium breve UCC2003

Annotation: RNA polymerase sigma factor RpoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 16 to 184 (169 residues), 97.2 bits, see alignment E=3.9e-32 PF04542: Sigma70_r2" amino acids 25 to 87 (63 residues), 52.1 bits, see alignment E=6.8e-18 PF08281: Sigma70_r4_2" amino acids 128 to 180 (53 residues), 51.4 bits, see alignment E=1e-17 PF04545: Sigma70_r4" amino acids 133 to 181 (49 residues), 31.6 bits, see alignment 1.5e-11

Best Hits

Swiss-Prot: 43% identical to SIGH_MYCS2: ECF RNA polymerase sigma factor SigH (sigH) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 88% identity to blf:BLIF_1286)

Predicted SEED Role

"RNA polymerase sigma-70 factor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>BBR_RS16820 RNA polymerase sigma factor RpoE (Bifidobacterium breve UCC2003)
MPAEAGESMAAKRARFEQLAMPAVNTLYRQAMRLTNNPDDAQDLVQDTFERGFKAFDSFQ
PGSNFEAWMTTIERNAYFNQYAKAKRRPQRANDSTGEYDDWDIYDASEHTSDGLKSAEQE
YLDAFAPEEIMAALAKLSPERRQVFIDAAIDGKSYQQVADEQGVKIGTVMSRLNRARTQL
KRELASYAKDRGYITGSPSAKLGENVGQTVEHVHNGTSEHTVDSDDAAQTITDTVARARM
LRQSRKPQGNEMR