Protein Info for BBR_RS16785 in Bifidobacterium breve UCC2003

Annotation: thiamine diphosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01378: thiamine pyrophosphokinase
  • amino acids 5 to 207 (203 residues), 109 bits, E=1.1e-35
• PF04263: TPK_catalytic
  • amino acids 24 to 114 (91 residues), 62 bits, E=4.8e-21
• PF04265: TPK_B1_binding
  • amino acids 148 to 205 (58 residues), 29.2 bits, E=5.8e-11

Best Hits

KEGG orthology group: K00949, thiamine pyrophosphokinase [EC: 2.7.6.2] (inferred from 92% identity to blb:BBMN68_255)

Predicted SEED Role

"Thiamin pyrophosphokinase (EC 2.7.6.2)" in subsystem PnuC-like transporters or Thiamin biosynthesis (EC 2.7.6.2)

MetaCyc Pathways

• thiamine diphosphate salvage IV (yeast) (6/7 steps found)
• thiamine diphosphate salvage III (1/1 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (2/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (2/3 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (5/8 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (4/7 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.2

Protein Sequence (241 amino acids)

>BBR_RS16785 thiamine diphosphokinase (Bifidobacterium breve UCC2003)
MSKVCVIFGAGEYYDGTPVVPDGAYVVAADGGLDHTRELGIVPDVVVGDFDSLEGRPPRT
DVRTITLPSLKDDPDMLSALRVGWAAGCREFHVYGGLGGRIDHTISGIQLMTLLAGHGAS
GYLYGDGLIVTAITDGKLSFPAHPVPEDGRMVSAFSHSDVSLGVNEPGLKYELKDSTLTN
TMVQGVSNEFRDGIDAAISVEHGTLIVTFPIEVALPQVSRFHEFSGGIGKLDTEVSKLLV
R