Protein Info for BBR_RS16775 in Bifidobacterium breve UCC2003

Annotation: translation initiation factor IF-3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05198: IF3_N
  • amino acids 32 to 101 (70 residues), 104 bits, E=3.8e-34
• TIGR00168: translation initiation factor IF-3
  • amino acids 32 to 195 (164 residues), 188.6 bits, E=3.3e-60
• PF00707: IF3_C
  • amino acids 109 to 193 (85 residues), 114 bits, E=2.5e-37

Best Hits

Swiss-Prot: 58% identical to IF3_STRCO: Translation initiation factor IF-3 (infC) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 98% identity to blm:BLLJ_1238)

Predicted SEED Role

"Translation initiation factor 3"

Protein Sequence (261 amino acids)

>BBR_RS16775 translation initiation factor IF-3 (Bifidobacterium breve UCC2003)
MNHRALIAFHQGALPKELKQRIGVIISDEPRINDEIRVPQVRLIGPKGEQVGVIATTVAL
NLAKEANLDLVEVAPNAKPPVAKLIDYGKFKYNEKIKAREARRNQSTAEIKEIRFRLKID
DHDFDVKKGHVTRFLNGGDKVKVTIMLRGREISRPIGGVELLQRLADDVEEFGTVESKPK
QEGRNIIMTLAPKGKKVHTQSEQRRRGAESRAERQARQAARLAAKQESQAQAAADAKTAI
SQKTSDKKQTSKEGSNAEDEN