Protein Info for BBR_RS16735 in Bifidobacterium breve UCC2003

Annotation: NUDIX hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF00293: NUDIX" amino acids 56 to 161 (106 residues), 27.6 bits, see alignment E=2.7e-10 PF19368: AraR_C" amino acids 173 to 240 (68 residues), 45.3 bits, see alignment E=8.6e-16

Best Hits

KEGG orthology group: None (inferred from 81% identity to blf:BLIF_1267)

Predicted SEED Role

"narrowly conserved hypothetical protein possibly in the MutT/Nudix family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>BBR_RS16735 NUDIX hydrolase (Bifidobacterium breve UCC2003)
MGFGNVSERRSAPPQVGVSVVILALGPDDMPEHGATQAESAETGAGTPHSRLWLPLVKRV
RQPFLGTWALPGGDLRSDWSLEQSAYSALESTTALHPRYLEQLYTFGGPERSHGGLPMVS
VVYWALVGQAEAAHFEDGDNVRWFPEDELPPLAFDHREIIDYALLRLRSKIEYSDVATRL
LGPTFTLRQLHGVYEAIAGESLDLANFRRKMLSSGDLEDTGEKVREGRQRPAAVYRYVPQ
LPAHTGTPHEFDGSGIAAMAKRNERKDVLAALSPSAQI