Protein Info for BBR_RS16730 in Bifidobacterium breve UCC2003

Annotation: quinolinate synthase NadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 70 to 424 (355 residues), 316.6 bits, see alignment E=8.6e-99 PF02445: NadA" amino acids 76 to 422 (347 residues), 345.9 bits, see alignment E=8.9e-108

Best Hits

Swiss-Prot: 69% identical to NADA_CORGL: Quinolinate synthase A (nadA) from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 97% identity to bll:BLJ_1227)

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>BBR_RS16730 quinolinate synthase NadA (Bifidobacterium breve UCC2003)
MTASFIAPSVDEIIAKLGAQSTCDAGLTQDPWHFDTTTPSYGPGASMLDRLPANAPRQQV
LPDEYRKASDEELQQRITDAKQRLGSKLLILGHFYQRDEIIKHADFVGDSFQLAKNATER
PDADHIVFCGVHFMAETADILSTPEQSVTLPNLSAGCSMADMANIDQVQECWDQLGEICG
TEPDSDGRQQIIPVTYMNSSAALKAFCGRNGGIVCTSSNAHAVLEWAFARGKRVLFFPDQ
HLGRNTARAMGIPLSEMPLWDPFKAQGGASDPADYARAKMILWKGFCSVHQRFTVEQIER
ARKAYPGVKVIVHPECSMQVVDAADGTGSTAYIVKEIANAPAGSAIAVGTEINLVNRLAA
QYPDKTVFCLDPVVCPCSTMYRIHPAYLAWALENLEQGNVVNRIIVDDNTAREAKVALER
MLRVHP