Protein Info for BBR_RS16715 in Bifidobacterium breve UCC2003

Annotation: cysteine desulfurase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00266: Aminotran_5
  • amino acids 15 to 93 (79 residues), 58.9 bits, E=4.6e-20
  • amino acids 134 to 417 (284 residues), 154.5 bits, E=4.2e-49
• PF01212: Beta_elim_lyase
  • amino acids 161 to 233 (73 residues), 27.2 bits, E=2.4e-10

Best Hits

KEGG orthology group: K04487, cysteine desulfurase [EC: 2.8.1.7] (inferred from 85% identity to bbp:BBPR_0602)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7)" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

• superpathway of L-alanine biosynthesis (4/4 steps found)
• L-alanine biosynthesis III (1/1 steps found)
• L-cysteine degradation IV (1/1 steps found)
• cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
• superpathway of thiamine diphosphate biosynthesis II (7/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (4/7 steps found)
• bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
• superpathway of thiamine diphosphate biosynthesis I (6/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
• tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
• molybdopterin biosynthesis (1/6 steps found)
• tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)
• [2Fe-2S] iron-sulfur cluster biosynthesis (2/10 steps found)
• tRNA-uridine 2-thiolation and selenation (bacteria) (1/11 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7

Protein Sequence (432 amino acids)

>BBR_RS16715 cysteine desulfurase (Bifidobacterium breve UCC2003)
MADTPNTSSEAGELYLDAAATEPVSPAVLEAMTPFLTDAYANPASVHQPGKTAARALDAA
RASFAAALGARPDDVIFTSGGTESDNLAIKGIAMARMRQLGLQPFYGLAEDDGEQFGTDL
ADPSALSQTGEQTTNHRPRIIISAIEHPAVAQSAAWLHEWFGFDVVHIPVDAQAHLDLDA
LEHELDGEAGERTALVSTMLANNEVGTVEPVEELVRIAHKHGVPIHVDAVQAAGQIPIRF
RDWDVDALSVSGHKFGTPKGLGALLVRGRTSIEPVLSGGGQERGLRSGTQNVAGAVALAI
GLNESNARMQAHYRELVASRDMLIDAVRRVAPRADLTGDPERRLPGHASFIFPGVTGEAL
LVDLDARGIAASSGSACAVGRHEIPPTLLAMGLEPSIAKSALRMTFRTPLTREQVERISL
AIEESYTDLTRY