Protein Info for BBR_RS16700 in Bifidobacterium breve UCC2003

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 37 to 184 (148 residues), 125.6 bits, E=1.2e-40

Best Hits

Swiss-Prot: 43% identical to Y1508_METJA: Uncharacterized ABC transporter ATP-binding protein MJ1508 (MJ1508) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02003, (no description) (inferred from 100% identity to bll:BLJ_1221)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Protein Sequence (253 amino acids)

>BBR_RS16700 ABC transporter ATP-binding protein (Bifidobacterium breve UCC2003)
MTSPVLSSLPQSSPCALELHDVTRVHGKDARRVTALSHANLTLRPGEFVAIMGPSGSGKS
TLLNLAGGLDVPTQGHVLVEGRDLATLSVAERAAIRRKSIGYVFQDFNLLPSLSAAENVS
FPLELDGWNPRKAREAAMQSLNEVGVADMADRRPEDMSGGQAQRVAIARALVGPRRLLLA
DEPTGALDSNAGMTILEVLRTRADRGAAVLLVTHEPRFAAWADRTVFLKDGRIIDETGSS
NMDDLLNLEERGA