Protein Info for BBR_RS16660 in Bifidobacterium breve UCC2003

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF00005: ABC_tran" amino acids 44 to 190 (147 residues), 119.6 bits, see alignment E=8.5e-39

Best Hits

Swiss-Prot: 42% identical to BCEA_BACHD: Bacitracin export ATP-binding protein BceA (bceA) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K02003, (no description) (inferred from 81% identity to bad:BAD_1064)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>BBR_RS16660 ABC transporter ATP-binding protein (Bifidobacterium breve UCC2003)
MARHSAKGVAQSIEQAEEQHDHVVARAVDLTKTYGDADSQVVALDHVNVEFQRGQMTAIM
GPSGSGKSTLMHCMAGLDQPTSGKVFVEGLEVSSMGQKQLTDLRRAQIGFIFQSFNLVPT
LCAEENILLPLQIAKKPIDRDWFKQVVKVVGLEKRLTHRPSQLSGGQQQRVACARAMMAR
PSVIFADEPTGNLDSRSSREVLGFLKQSVAEYGQSIVMVTHDPRAASYADRVLVLADGHI
TQDLDHPTYEQILEVFADDGADEAGKVAQA