Protein Info for BBR_RS16635 in Bifidobacterium breve UCC2003

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 669 PF00005: ABC_tran" amino acids 41 to 297 (257 residues), 87.7 bits, see alignment E=5.4e-28 amino acids 432 to 583 (152 residues), 113.6 bits, see alignment E=5.2e-36 PF08352: oligo_HPY" amino acids 348 to 380 (33 residues), 26.3 bits, see alignment (E = 3.4e-09) amino acids 635 to 660 (26 residues), 18 bits, see alignment (E = 1.3e-06)

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 99% identity to bln:Blon_0925)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (669 amino acids)

>BBR_RS16635 ABC transporter ATP-binding protein (Bifidobacterium breve UCC2003)
MTDNTNATMLAMQKEHGPLLEVRNLAIDFTTDTGKPVHAVRDANFTVYPGQWVAIVGESG
SGKSTSAMAVLGLLPGTGHVVNGSIKLDGEEIAGAKQSEFDKLRGTKMGLVPQDPMSNLN
PVWRIGTQVKEALKANNMDVDHEKRSALAKALAGDEVEVKGNDDETFLGAKELPELMTEA
KKALTEAGVSGEAFDKAVARFTNEWVPGSETRWRVADDLIKAGVADDQAWYLAKKYVIGS
TMDDRIAGLLSEAGLPDAATRARQFPHEFSGGMRQRALIAIGLACRPDLLIADEPTSALD
VTVQKRILDHLHMLTDSLGTAVLFITHDLGLAAERAQRIVVMYKGQVVESGPSLEVLQHP
QHPYTKRLVAAAPSLASQRIISAKERGENADALLGHHIAGESTLEKSEHIITVDHLTKEF
KLPRKKEMFKAVDDVSFSVKRGTTLAIVGESGSGKSTVANMVLHLLKPTSGKVFYEGRDT
STFKAKDLLGFRRHVQPVFQNPYGSLDPMYSIFRSIEEPLRIHKIGDKKSRANRVKELLD
MVEMPASVMGRYPNELSGGQRQRIAIARAMALDPDVIVCDEAVSALDVLVQDQVLRLLND
LQAEKGLSYLFITHDLAVVRQIADEVVVMQHGKLVEHATTDEVFDHPQKQYTRDLLDAIP
GGKLQLGLD