Protein Info for BBR_RS16615 in Bifidobacterium breve UCC2003

Annotation: class I SAM-dependent RNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 4 to 42 (39 residues), 28.3 bits, 1.9e-10
• PF05958: tRNA_U5-meth_tr
  • amino acids 221 to 415 (195 residues), 56.8 bits, E=3e-19
• PF03602: Cons_hypoth95
  • amino acids 274 to 366 (93 residues), 24.6 bits, E=2.7e-09

Best Hits

Swiss-Prot: 90% identical to Y1394_BIFLO: Uncharacterized RNA methyltransferase BL1394 (BL1394) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 90% identity to blm:BLLJ_1210)

Predicted SEED Role

"RNA methyltransferase, TrmA family"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (419 amino acids)

>BBR_RS16615 class I SAM-dependent RNA methyltransferase (Bifidobacterium breve UCC2003)
MQAEVRIERYADQGRCVAHIDGRVVFVRFALPGELVRIELDEPHDRDDRFWTGEVIEVLE
ASEDRVDPAWSLAGPLAMGGGVGGADLVHVSLPGQLKWKAITVSEQMSRLGHIDAAVPID
RMPGDEELDGLHWRTRIEMIADENGKPSMRRRGTHTRVAIDTMPLATRALLDVAEREHVW
EGGFEPGSQIRLSVPEPRGDADIAADDYAVLIDGELRNGSQLLTEQVTINGKTFDYRVDA
NGFWQVHRQAPIALGTHVINQVNQQLQGAVAPVIWDLYSGSGLFTLPLATMTGERTRMLS
VEGARVAVKNAQRNLRAMNLNDVDARAGDVSRTLEHVPAHLAKPDIVVLDPPRAGARAKV
CRQIAAAGASSVVYIACDPTSLARDTATLIGEGYELKDIRAFDIYPMTHHVETVAVFSR