Protein Info for BBR_RS16605 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 870 transmembrane" amino acids 48 to 68 (21 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 260 to 285 (26 residues), see Phobius details amino acids 668 to 692 (25 residues), see Phobius details amino acids 698 to 719 (22 residues), see Phobius details amino acids 731 to 753 (23 residues), see Phobius details amino acids 769 to 787 (19 residues), see Phobius details amino acids 799 to 825 (27 residues), see Phobius details amino acids 831 to 855 (25 residues), see Phobius details TIGR01494: HAD ATPase, P-type, family IC" amino acids 78 to 334 (257 residues), 94.9 bits, see alignment E=1.9e-31 amino acids 575 to 696 (122 residues), 85.1 bits, see alignment E=1.8e-28 PF00122: E1-E2_ATPase" amino acids 107 to 293 (187 residues), 142.7 bits, see alignment E=1.4e-45 PF00702: Hydrolase" amino acids 500 to 622 (123 residues), 46.3 bits, see alignment E=1e-15 PF08282: Hydrolase_3" amino acids 593 to 643 (51 residues), 25.4 bits, see alignment 1.8e-09

Best Hits

Predicted SEED Role

"probable cation-transporting ATPase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (870 amino acids)

>BBR_RS16605 hypothetical protein (Bifidobacterium breve UCC2003)
MSATAAVEMPEISETGLTVKEVSQRIESGQSNAVKTSTSRSVKDIVRANVFTLFNGIIFV
AMVMVLVTGSWRDAVFGFVIIINTGIGIFTELKAKRTLDKLSILVASDFLVRRDGKDIEV
PHNEIVLGDLLWIRSGEQVPADGQIIQTWGLELDESMLTGESRTVRHKVGEQVYSGATAV
SGMALVKVNAVGSHSYAATLTAQAKVYKKTVSDLNKGINTILKFMTFLVVPLCILLILSQ
IHTVGGWDAALSTGEWRQAVVSAVAGVVGMIPEGLVLLTSLNFAVAAMRLARHNTLVQEL
ESVETLARVDALNLDKTGTITDGGIAFNQLIMLGSRWRELPAQPTEGGSFETLTEQAATQ
ALYDCCNEEQPNGTGQAVLAGLKAQGYEPGQVESRVPFSSARKWSAVVKPILPPAGGDSR
SESEGGRTEITPSHLAMTAPASGGETWYMGAPEVIISALGGDYSDVLQQVNDYANDGNRV
LLVARSTASLADTDNPQIDPQAKPVALVLCSEKIREDAEQTLAWFREQGVRCRVISGDNP
VTVGAIARKVRLTGEHEPRFMDARELPEDVNELARVLENVDVLGRVLPNQKKAIVQALHT
QNHVVAMTGDGVNDALAIKEADLGIAMGNAAPATKAVAQVVLVDSKFSHLPDVVARGRQV
MANMERVASLFLVKTVYSALISLGVVLTQIPYPYLPRHITYIGALTIGMPAFILALAPNT
RRYIPGFLKRVVTFALPGGIATALSVLLTAWFLPGIMGWDVTKNVDLSALRATSAIILFL
MGVFVLARVAQPLNSWRGILVAAFAAAGVIGAFIPFVANFFALILPTGTTLVATLIALGG
SALIFVICLWLAPLVGKVSGKLLRQHGFNI