Protein Info for BBR_RS16580 in Bifidobacterium breve UCC2003

Annotation: EamA/RhaT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 115 to 135 (21 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 164 to 188 (25 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details PF00892: EamA" amino acids 2 to 63 (62 residues), 38.8 bits, see alignment E=5.2e-14 amino acids 170 to 301 (132 residues), 53.8 bits, see alignment E=1.2e-18

Best Hits

KEGG orthology group: None (inferred from 83% identity to blo:BL1406)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>BBR_RS16580 EamA/RhaT family transporter (Bifidobacterium breve UCC2003)
MLCLLLTALIWGFAFVAQVQGMDSMSPMFFNATRFTLGALSLVPILLWQRGRGSSSTSEA
ADTAAVGAGDQLVQTSSPAIRLLANPIIISVICGIVLFTASTLQQYGILYGKSAGRAGFL
TAMYIVMVPLLAFVFLRRRIGVLVFAAVALSIAGFYSLCITDGFGSIGLADILLVFTAVL
FAVHILVIDTLGAKVDAIKLSFGQFCTTAVLSWTGSLIEGSVDWAGAAHSWIPILYAGFG
SVGIAYTLQVVGQQWVPPTRASLLMSLESFFSAVGGALLLGEVMTPRGYLGCALIFIGTL
LAQAPAKLPKFLRKD