Protein Info for BBR_RS16550 in Bifidobacterium breve UCC2003

Annotation: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 19 to 193 (175 residues), 141.3 bits, see alignment E=1.6e-45 TIGR00560: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase" amino acids 19 to 204 (186 residues), 140.8 bits, see alignment E=3.6e-45

Best Hits

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 92% identity to blb:BBMN68_301)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.5

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>BBR_RS16550 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (Bifidobacterium breve UCC2003)
MDKQSTPKSSLFDGWNAPPNLVTYSRIVLVVIFLVLDIMAGEWGANNLTMRWVAAVLFII
AASTDKIDGWMARKYNQVTEMGKLMDPIADKLLTCGAMIVCSAFGELAWWVTILFLIREI
GITVMRFFVMERPGGKVIAAAWPGKLKTVFECVGLAMLLLPMWSLGSGQSTPFWMTAYYF
LTYAIIYVALVLCLYSGVIYLYNTFVGTKKQ