Protein Info for BBR_RS16530 in Bifidobacterium breve UCC2003

Annotation: recombinase RecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 TIGR02012: protein RecA" amino acids 23 to 341 (319 residues), 573.8 bits, see alignment E=5.3e-177 PF00154: RecA" amino acids 26 to 286 (261 residues), 476.1 bits, see alignment E=6e-147 PF08423: Rad51" amino acids 54 to 245 (192 residues), 33 bits, see alignment E=8e-12 PF06745: ATPase" amino acids 57 to 223 (167 residues), 32.6 bits, see alignment E=1.1e-11 PF21096: RecA_C" amino acids 289 to 344 (56 residues), 84.3 bits, see alignment 1.1e-27

Best Hits

Swiss-Prot: 100% identical to RECA_BIFBR: Protein RecA (recA) from Bifidobacterium breve

KEGG orthology group: K03553, recombination protein RecA (inferred from 97% identity to bln:Blon_0949)

MetaCyc: 65% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>BBR_RS16530 recombinase RecA (Bifidobacterium breve UCC2003)
MALETKPAQDPATETKHELDPKRKAALDTALAQVEKSFGKGSAMRLGDQPVQNVEVIPTG
SLALDMALGIGGLPKGRIVEIYGPESSGKTTLALHVVANAQKKGGVAAYIDAEHALDPAY
ARKLGVDTDSLIVSQPDNGEQALEIADMLIRSGALDVIVIDSVAALVPKAEIEGEMGDSH
VGLQARLMSQALRKMTGALAQAGTTAIFINQLREKIGVFFGNPETTTGGKALKFYASVRL
DIRRIQTLKNGDEAVGNRTRVKVVKNKMAPPFKSAEFDMLYGEGISREGSVIDMAQQVGV
VKKSGSWFTYEGDQLGQGREKVRQFLKDNPAITEEIENKVKAEFGLIGSADQFAEDEDAA
AAAAVSEAAAADAAKDTKATAAPAAKSSRAKA