Protein Info for BBR_RS16480 in Bifidobacterium breve UCC2003

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 PF00140: Sigma70_r1_2" amino acids 172 to 205 (34 residues), 50.2 bits, see alignment (E = 3.9e-17) TIGR02393: RNA polymerase sigma factor RpoD" amino acids 234 to 470 (237 residues), 373.1 bits, see alignment E=5.9e-116 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 234 to 459 (226 residues), 122.9 bits, see alignment E=1e-39 PF04542: Sigma70_r2" amino acids 238 to 308 (71 residues), 83.3 bits, see alignment E=1.7e-27 PF04539: Sigma70_r3" amino acids 317 to 393 (77 residues), 98.7 bits, see alignment E=3.4e-32 PF04545: Sigma70_r4" amino acids 406 to 459 (54 residues), 61.7 bits, see alignment 7.4e-21

Best Hits

KEGG orthology group: K03086, RNA polymerase primary sigma factor (inferred from 86% identity to blf:BLIF_1214)

Predicted SEED Role

"RNA polymerase sigma factor RpoD" in subsystem Flagellum or Macromolecular synthesis operon or Transcription factors cyanobacterial RpoD-like sigma factors or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>BBR_RS16480 RNA polymerase sigma factor (Bifidobacterium breve UCC2003)
MATKETTATKQTAESSEETETKKKASSTTARKTSAKKTKDTKGTTAAKTGEKTSRKTSAK
KVKKEEELPQNDISQSDDPEDLDVDNLDEDLDDVESEDVDDLEDADAESDDEDIDDEDDE
DEEDEGKAASKAPEQPKEKGAYVVSDTDDEEENIIPAGNPKRRVIAAGATADPVKDYLKQ
IGRVSLLNAEQEVDLSERIEAGLYAQHLLDTESEGMEFKRKRELKWAAADGKKAKDHLLE
ANLRLVVSLAKRYTGRGMLFLDLIQEGNLGLIRAVEKFDWKKGFKFSTYATWWIRQAITR
AMADQARTIRVPVHMVEVINKLSRVQRQMLQDLGREPTPDELARELDMPVEKVQEVQKYG
REPISLHTPLGEDGDSEFGDLIEDTDAIAPSDAVAFSLLQEQFKQVLETLSPREAGVIKM
RYGLEDGQPKTLDDIGRVYGVTRERIRQIESKTMSKLRHPSRSQTLRDFLDQ