Protein Info for BBR_RS16470 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 259 to 277 (19 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 347 to 367 (21 residues), see Phobius details amino acids 370 to 393 (24 residues), see Phobius details PF07690: MFS_1" amino acids 10 to 254 (245 residues), 59.3 bits, see alignment E=1.6e-20 amino acids 227 to 391 (165 residues), 44.4 bits, see alignment E=5.3e-16

Best Hits

KEGG orthology group: None (inferred from 90% identity to blo:BL1430)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>BBR_RS16470 MFS transporter (Bifidobacterium breve UCC2003)
MASLLLAVIYVAFISLGLPDSLLGSAWPTMSQDLNVPVSWAGGISAVISMFTIVSALLSD
RMTLKFGAGKVTAVSVALTAMALAGFSVAPNYWVLLLIAIPYGLGAGGVDAALNNYVAIH
YESRHMSWLHCMWGVGASVGPYIMGYALSQGQGWPWGYRYIAILQVMLTVILVFSLPLWK
KRGIAAAGESSGETAQSDENTDGETVAERKPLGVAGVLAIRGAKEILVMFFCYCAIESTA
GLWASSYMVMHSGIDKITAASWASLFYVGITVGRALSGFLTMRFKDPVMIRLGQVLVLAG
ILVMFVPLPHHLGVVAGLIIVGLGCAPIYPCVIHSTPVYFGEDNSQAIVGVQMACAYVGS
LLMPPLFGVIAQYVTISLYPWYLLVLLVLMVAMHERLRKLRG