Protein Info for BBR_RS16350 in Bifidobacterium breve UCC2003

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 77 to 104 (28 residues), see Phobius details amino acids 116 to 139 (24 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 101 to 274 (174 residues), 56.6 bits, see alignment E=1.4e-19

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to blo:BL1332)

Predicted SEED Role

"ABC-type sugar transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>BBR_RS16350 carbohydrate ABC transporter permease (Bifidobacterium breve UCC2003)
MAGTHAVMENKYNHVTPGKVVRIIVLIALLLFLAAPLLWQISLAFKGPKDDMYAAPYLIP
VDPTIQNFVDVFNRLPLLFYVCNTLIVAALNIGGNIISGCFAGYSIALLKFKGKGLVVGL
LFLSMLVPGETILISQFLIIRNLQLQNNLIGVALPGLVSSMNILLFMNAFKAIPREMIEA
AEVDGANVWQRFWRVCVPQVKGTMALVGIFSFMGSWNDFLWPLIVLTDDSHYTLTLGMSR
LQGTFVSDPRVVAAGTIIALVPIMIFFLVFQRYIFNGLEAGSVKE