Protein Info for BBR_RS16285 in Bifidobacterium breve UCC2003

Annotation: magnesium transporter CorA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 251 to 271 (21 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details PF01544: CorA" amino acids 21 to 311 (291 residues), 182.3 bits, see alignment E=6.9e-58

Best Hits

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 95% identity to bll:BLJ_1138)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>BBR_RS16285 magnesium transporter CorA family protein (Bifidobacterium breve UCC2003)
MLRIFSSINGQVEQIEKSENGSWLCLSEPTDVELATVASQTGIDLADLRAPLDDEERSRV
DVEDEYTMIIVDIPTVEERGGRDWYETIPLSIIVTENLIITVCMQDTPVLHPFMEGTIRG
FNTFMRSRFILQILYRNATMYLRYLRIIDRESDKLELKLRHSMQNREIVMLMELSKTLVY
FTTSLKSNEIVMEKLTTLSRIKQYPDDEDLLDDVITENKQAIEMANIYSGVLANMTDAFA
SIVSNNLNNVMRIFTIISITLSIPTLIFSMYGMNFQGGMLGMPFSDKPWGFITIVVISVA
LSILVTWFLTRSRMFK