Protein Info for BBR_RS16265 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 56 to 74 (19 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 334 to 350 (17 residues), see Phobius details amino acids 356 to 374 (19 residues), see Phobius details amino acids 380 to 397 (18 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details amino acids 441 to 465 (25 residues), see Phobius details amino acids 469 to 491 (23 residues), see Phobius details amino acids 504 to 525 (22 residues), see Phobius details PF03772: Competence" amino acids 272 to 522 (251 residues), 140.3 bits, see alignment E=3.8e-45 TIGR00360: ComEC/Rec2-related protein" amino acids 281 to 454 (174 residues), 75.6 bits, see alignment E=2.9e-25

Best Hits

KEGG orthology group: None (inferred from 67% identity to blb:BBMN68_357)

Predicted SEED Role

"FIG00672410: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (568 amino acids)

>BBR_RS16265 hypothetical protein (Bifidobacterium breve UCC2003)
MSMDWALREQGSRDWRMLPVALTMWAASLGSHSAFAWWSEREADALPSDGIGWERLLPGG
MACLVLILVVLLAHHLRMRWPGVLAVCIAAACVGSMTTIAADTIVWHDSAMTQARQSSVQ
SAITATVTAPVVASDQRGYDCQVDVRFSVIVIEGTDRGSVAKARVYADDPYCARMHRGAA
YRLVGTLQQARYGRMPLWLLVDGSQPLAQVRDPPLHYALISRMQQAFFMVIEQLPDQGRV
LVPGLTMGILGQDYVGTDSQSMPIHATYANILEDRFRKSGIMHLMAVSGGHFVLLAGLVR
RLGRWMLMDRRLTAVMIASMYVLLAAAMFPGDSVTRALIMGMMGAASHAMGRRSQALSAL
CWTVVGVLVVSPGMSTSYGFALSSAAVLGIVLFAGRLSRVLGHVLPHSLAEMMAMTIAAQ
LFTLPIQVLMEPELPLLSVPANLLVAPFVGLSTITGLMSLALAWCMPWLAGVFAWVSSWG
TLVMERVAMWLGSNEMATLPWKDGVVGAALILLAELGIGALLVLVTRQVKRVRQPEAGLP
GIRFGSVWRVRLTLWIEESRRLLSGDSS