Protein Info for BBR_RS16150 in Bifidobacterium breve UCC2003

Annotation: GuaB3 family IMP dehydrogenase-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01304: IMP dehydrogenase family protein
  • amino acids 5 to 368 (364 residues), 549.2 bits, E=2.6e-169
• PF00478: IMPDH
  • amino acids 16 to 300 (285 residues), 136.2 bits, E=2.1e-43
• PF01070: FMN_dh
  • amino acids 176 to 298 (123 residues), 34.7 bits, E=1.6e-12
• PF01645: Glu_synthase
  • amino acids 206 to 287 (82 residues), 20.5 bits, E=3.6e-08

Best Hits

Swiss-Prot: 51% identical to Y1603_MYCS2: Uncharacterized oxidoreductase MSMEG_1603/MSMEI_1564 (MSMEG_1603) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 97% identity to bln:Blon_1052)

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (39/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (18/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (21/26 steps found)
• guanosine ribonucleotides de novo biosynthesis (3/4 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (4/6 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (5/8 steps found)
• inosine 5'-phosphate degradation (2/4 steps found)
• superpathway of purine nucleotide salvage (9/14 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• ureide biosynthesis (2/7 steps found)
• purine nucleotides degradation II (aerobic) (4/11 steps found)
• superpathway of purines degradation in plants (7/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Protein Sequence (374 amino acids)

>BBR_RS16150 GuaB3 family IMP dehydrogenase-related protein (Bifidobacterium breve UCC2003)
MSQEIEIGLGKKGRLGYALDDVAIVPSRRTRDPEDVSTSWQIDAYEFDVPVIGAPMDSVT
SPATAIAMGKMGALGVLDLEGLWTRYEDPTSLLDEIAGLPAEEATTRIQQIYAESVKPEL
ITQRLHEIRNAGVTVAGALSPQRTQQFYSTVVDAGVDLFVIRGTVVSAEHVSSGQEPLNL
KKFIYDLDVPVIVGGASNYTAALHLMRTGAAGVLVGFGGGAVSATRQTIGVQAPMATAIA
DVAEARRDYMDESGGRYVQVIADGGMGDSGSFVKALALGADAVMLGAPLARATEAPGKGT
HWGAEARHQTLPRGYRTTVGTVGSLEQVLFGPSHEADGKTNFIGALKRAMASTGYVDVKN
FQRCGMVVNPYSSR