Protein Info for BBR_RS16135 in Bifidobacterium breve UCC2003

Annotation: peptide deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF01327: Pep_deformylase" amino acids 3 to 149 (147 residues), 135.2 bits, see alignment E=7.7e-44 TIGR00079: peptide deformylase" amino acids 7 to 154 (148 residues), 107.1 bits, see alignment E=3.3e-35

Best Hits

Swiss-Prot: 94% identical to DEF2_BIFLO: Peptide deformylase 2 (def2) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K01462, peptide deformylase [EC: 3.5.1.88] (inferred from 94% identity to blb:BBMN68_370)

Predicted SEED Role

"Peptide deformylase (EC 3.5.1.88)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase (EC 3.5.1.88)

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.88

Use Curated BLAST to search for 3.5.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>BBR_RS16135 peptide deformylase (Bifidobacterium breve UCC2003)
MAIREIRVVPDPVLRTPCDEIKEITPAVRRLVDDLLETVDDPGRAGLSANQIGVSLRAFS
YNIDGKVGYVLNPVLEEKSGEQYGDEGCLSVPGLWYKTRRAEYARVRGIDLDGKEVVLEG
TGIMGRMLQHECDHLDGHVYLDRLEKEERRAAMKYMREHQK