Protein Info for BBR_RS16130 in Bifidobacterium breve UCC2003

Annotation: 30S ribosomal protein S2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01011: ribosomal protein uS2
  • amino acids 4 to 225 (222 residues), 332.3 bits, E=5.8e-104
• PF00318: Ribosomal_S2
  • amino acids 9 to 225 (217 residues), 316 bits, E=4.8e-99

Best Hits

Swiss-Prot: 96% identical to RS2_BIFLO: 30S ribosomal protein S2 (rpsB) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K02967, small subunit ribosomal protein S2 (inferred from 96% identity to bln:Blon_1056)

MetaCyc: 50% identical to 30S ribosomal subunit protein S2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S2p (SAe)" in subsystem Ribosome SSU bacterial

Protein Sequence (279 amino acids)

>BBR_RS16130 30S ribosomal protein S2 (Bifidobacterium breve UCC2003)
MAQITMSEMLKAGLHFGHQTRRWNPKMKQFILTQRNGIHIINLFKSLDMIDKAYDFIKTT
VAHNGTVLFVGTKKQAQEAIANQATRVNMPYVSERWLGGMLTNFQTVSKRVNRLKELEEM
DFSDVHGSGLTKKELLLLEREKDKLNKQLGGIRNMNRTPSAMFVVDITKESLAVEEAHKL
GIPVVALVDTNADPDTVEYPIPANDDAIRGIELLTSLMADAVAEGLLERSGQAAKAEGET
AEQPMAAWEKELLTNEAPAEAEAAAPAAAEETAEAPKAE