Protein Info for BBR_RS16115 in Bifidobacterium breve UCC2003

Annotation: ribosome recycling factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 TIGR00496: ribosome recycling factor" amino acids 8 to 183 (176 residues), 204.6 bits, see alignment E=4.4e-65 PF01765: RRF" amino acids 19 to 181 (163 residues), 209.3 bits, see alignment E=1.7e-66

Best Hits

Swiss-Prot: 94% identical to RRF_BIFLO: Ribosome-recycling factor (frr) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K02838, ribosome recycling factor (inferred from 92% identity to bln:Blon_1059)

Predicted SEED Role

"Ribosome recycling factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>BBR_RS16115 ribosome recycling factor (Bifidobacterium breve UCC2003)
MSLIDQAKEQMAKTVENTKENFAGIRTGRANPALLNGIVVDYYGAPTPIKAVASIGVPEP
RTLSVTPFDASQAAAVEKAIRNSDLGVSPNRDGNVIRLTMPELTEDRRKEYVKLAKSKAE
DGKVAVRNIRRKTKETIDKSVKDGDMGEDEGDRLLKDLDKVTKSITDEIDALLDTKQKEI
MEV