Protein Info for BBR_RS16090 in Bifidobacterium breve UCC2003

Annotation: phosphoribosyl-AMP cyclohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01502: PRA-CH
  • amino acids 42 to 114 (73 residues), 122.5 bits, E=2.7e-40

Best Hits

Swiss-Prot: 97% identical to HIS3_BIFLS: Phosphoribosyl-AMP cyclohydrolase (hisI) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K01496, phosphoribosyl-AMP cyclohydrolase [EC: 3.5.4.19] (inferred from 96% identity to blb:BBMN68_379)

Predicted SEED Role

"Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19)" in subsystem Histidine Biosynthesis (EC 3.5.4.19)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (39/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.19

Protein Sequence (131 amino acids)

>BBR_RS16090 phosphoribosyl-AMP cyclohydrolase (Bifidobacterium breve UCC2003)
MTDTIYDNSTELDPRIAARLKRDAKGLVAAVVQQYDTHEVLMVGYMNDEALRRTLTTGRV
TFWSRSRQEYWRKGDTSGHVQYVKGVSLDCDGDALLVEVDQVGAACHTGKRSCFLEGGPL
PVVEGHRPVEQ