Protein Info for BBR_RS16065 in Bifidobacterium breve UCC2003

Annotation: DUF488 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04343: DUF488
  • amino acids 5 to 112 (108 residues), 114.4 bits, E=2.5e-37

Best Hits

KEGG orthology group: None (inferred from 99% identity to bln:Blon_1429)

Predicted SEED Role

"probable uroporphyrin-III c-methyltransferase (EC 2.1.1.107)" (EC 2.1.1.107)

MetaCyc Pathways

• siroheme biosynthesis (2/4 steps found)
• factor 430 biosynthesis (2/7 steps found)
• cob(II)yrinate a,c-diamide biosynthesis II (late cobalt incorporation) (2/13 steps found)
• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (2/15 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (5/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (4/36 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.107

Protein Sequence (117 amino acids)

>BBR_RS16065 DUF488 domain-containing protein (Bifidobacterium breve UCC2003)
MGIAIKRIYEEPAASDGFRVLVDRLWPRGMTKERAALDLWLKAVSPSPSLRKWFGHDPAK
FAEFQARYVAELDANTAVEDLRCICAEHPDVTLLYAAKDPQVNHALVLRDYLNESLQ