Protein Info for BBR_RS16000 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 60 to 86 (27 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 254 to 277 (24 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 394 to 419 (26 residues), see Phobius details amino acids 435 to 456 (22 residues), see Phobius details PF02687: FtsX" amino acids 66 to 193 (128 residues), 34.5 bits, see alignment E=9.1e-13 amino acids 349 to 466 (118 residues), 26.1 bits, see alignment E=3.7e-10

Best Hits

KEGG orthology group: None (inferred from 99% identity to blb:BBMN68_496)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>BBR_RS16000 hypothetical protein (Bifidobacterium breve UCC2003)
MARYVLRVFRDNVTGWVPTILVVAVVTTLVGICMNQFVWTSSPSFTLAARQAGLDPAEFG
MVSVTIYVVVSLLAFFSLTVVGSATVNRIHSTFAQWRLMGASPSQVLASMWMLVGVASLF
GSLIGSLAAVPASLLAVPEFNAMAAESFADGFGSFAPPAFTPSMAAWLGSLLLGVATCML
GASIPSLRAAKIRPIEVIRGTGAIGIRHGWRSWAHWALGLIVMAAALALAFSGMGTPRAL
AFGQEAGQTFNSALWAGIIASFGMYILVSMLIPILLGIGRVVCRLCGSATGVLAARSAEA
KAASNTNTIAPLALAMGLSVTLLTCARSYGRILALGGHPKSLNYADSLLLITMLCIVSLA
TSMAVIALSNRSMVADQALLRSIGLSPRRVIRMYLWQSLQLAAGAVILSLIPVAVSASVF
AARSAALVGIPVAEIPWPGVIGMGTACWLALFLIQFTQIRPALHRSVADTIRTC