Protein Info for BBR_RS15940 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 89% identity to bln:Blon_1403)

Predicted SEED Role

"FIG00624406: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>BBR_RS15940 hypothetical protein (Bifidobacterium breve UCC2003)
MAGMIRAQARRIGMGLLTMPVACGIAVAAAGIMVSGVWSRTQTLTVVNWLAQLMVIGAGV
CVAVALTGDPLVEASESTPVGWRRVQATRFALAAVSCLAGAVLMFAPLHVLGLWPQDTGW
ISLIAPTGAVLVVGAAGFAAAAWSASTRATVMAVVAVWMFLALLWDPYVLDPVAQRGIPL
TVAVIAVGIAWHLLGDEERNVTLARRSI