Protein Info for BBR_RS15930 in Bifidobacterium breve UCC2003

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 25 to 181 (157 residues), 78.3 bits, see alignment E=2.5e-26 PF04542: Sigma70_r2" amino acids 29 to 94 (66 residues), 44.3 bits, see alignment E=1.9e-15 PF08281: Sigma70_r4_2" amino acids 127 to 177 (51 residues), 38.6 bits, see alignment E=1e-13 PF04545: Sigma70_r4" amino acids 144 to 179 (36 residues), 27.3 bits, see alignment 3e-10

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 97% identity to bln:Blon_1401)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>BBR_RS15930 RNA polymerase sigma factor (Bifidobacterium breve UCC2003)
MTSPGGAATRDGDLLARVASGDERAFETLYGRYAAAVRAFVRVRVPDAGTAEEVCADVWL
GCWRSARAFRGDAKVLSWLLGIAKRQIYMRVRRVRPNVTALDDAPEPRDDGPSPETAVLS
EAGVDDLMALLRRLPVELVETATLAWLHGLSYRQIADLSDVPEGTVKSRISRARRLLRAQ
LDR